PDB entry 4nqv

View 4nqv on RCSB PDB site
Description: Crystal Structure of HLA A*0101 in complex with NP44, an 9-mer influenza epitope
Class: Immune System/Viral Protein
Keywords: immune system, HLA presenting H7N9 viral epitope, T cell receptor, Immune System-Viral Protein complex
Deposited on 2013-11-25, released 2013-12-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.257
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: HLA class I histocompatibility antigen, A-1 alpha chain
  Species: Homo sapiens [TaxId:9606]
  Gene: HLA-A, HLAA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30443 (0-273)
• Chain 'B':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M, CDABP0092, HDCMA22P
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
    • expression tag (0)
• Chain 'C':
  Compound: HLA class I histocompatibility antigen, A-1 alpha chain
  Species: Homo sapiens [TaxId:9606]
  Gene: HLA-A, HLAA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30443 (0-273)
• Chain 'D':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M, CDABP0092, HDCMA22P
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
    • expression tag (0)
• Chain 'E':
  Compound: HLA class I histocompatibility antigen, A-1 alpha chain
  Species: Homo sapiens [TaxId:9606]
  Gene: HLA-A, HLAA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30443 (0-273)
  Domains in SCOPe 2.06: d4nqve1, d4nqve2
• Chain 'F':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M, CDABP0092, HDCMA22P
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
• Chain 'G':
  Compound: HLA class I histocompatibility antigen, A-1 alpha chain
  Species: Homo sapiens [TaxId:9606]
  Gene: HLA-A, HLAA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30443 (0-273)
• Chain 'H':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M, CDABP0092, HDCMA22P
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
    • expression tag (0)
• Chain 'I':
  Compound: HLA class I histocompatibility antigen, A-1 alpha chain
  Species: Homo sapiens [TaxId:9606]
  Gene: HLA-A, HLAA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30443 (0-273)
• Chain 'J':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M, CDABP0092, HDCMA22P
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
    • expression tag (0)
• Chain 'K':
  Compound: HLA class I histocompatibility antigen, A-1 alpha chain
  Species: Homo sapiens [TaxId:9606]
  Gene: HLA-A, HLAA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30443 (0-273)
• Chain 'L':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M, CDABP0092, HDCMA22P
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
    • expression tag (0)
• Chain 'M':
  Compound: nucleoprotein
  Species: H7N9 subtype, synthetic [TaxId:333278]
  Database cross-references and differences (RAF-indexed):
  • PDB 4NQV (0-8)
• Chain 'N':
  Compound: nucleoprotein
  Species: H7N9 subtype, synthetic [TaxId:333278]
  Database cross-references and differences (RAF-indexed):
  • PDB 4NQV (0-8)
• Chain 'O':
  Compound: nucleoprotein
  Species: H7N9 subtype, synthetic [TaxId:333278]
  Database cross-references and differences (RAF-indexed):
  • PDB 4NQV (0-8)
• Chain 'P':
  Compound: nucleoprotein
  Species: H7N9 subtype, synthetic [TaxId:333278]
  Database cross-references and differences (RAF-indexed):
  • PDB 4NQV (0-8)
• Chain 'Q':
  Compound: nucleoprotein
  Species: H7N9 subtype, synthetic [TaxId:333278]
  Database cross-references and differences (RAF-indexed):
  • PDB 4NQV (0-8)
• Chain 'R':
  Compound: nucleoprotein
  Species: H7N9 subtype, synthetic [TaxId:333278]
  Database cross-references and differences (RAF-indexed):
  • PDB 4NQV (0-8)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nqvE (E:)
  gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqkmeprapwieqegpeyw
  dqetrnmkahsqtdranlgtlrgyynqsedgshtiqimygcdvgpdgrflrgyrqdaydg
  kdyialnedlrswtaadmaaqitkrkweavhaaeqrrvylegrcvdglrrylengketlq
  rtdppkthmthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgt
  fqkwaavvvpsgeeqrytchvqheglpkpltlrw
  

  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  No sequence available.