PDB entry 4nqv

View 4nqv on RCSB PDB site
Description: Crystal Structure of HLA A*0101 in complex with NP44, an 9-mer influenza epitope
Class: Immune System/Viral Protein
Keywords: immune system, HLA presenting H7N9 viral epitope, T cell receptor, Immune System-Viral Protein complex
Deposited on 2013-11-25, released 2013-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.257
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class I histocompatibility antigen, A-1 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-A, HLAA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • expression tag (0)
  • Chain 'C':
    Compound: HLA class I histocompatibility antigen, A-1 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-A, HLAA
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • expression tag (0)
  • Chain 'E':
    Compound: HLA class I histocompatibility antigen, A-1 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-A, HLAA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqve1, d4nqve2
  • Chain 'F':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: HLA class I histocompatibility antigen, A-1 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-A, HLAA
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • expression tag (0)
  • Chain 'I':
    Compound: HLA class I histocompatibility antigen, A-1 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-A, HLAA
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • expression tag (0)
  • Chain 'K':
    Compound: HLA class I histocompatibility antigen, A-1 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-A, HLAA
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • expression tag (0)
  • Chain 'M':
    Compound: nucleoprotein
    Species: H7N9 subtype, synthetic [TaxId:333278]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NQV (0-8)
  • Chain 'N':
    Compound: nucleoprotein
    Species: H7N9 subtype, synthetic [TaxId:333278]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NQV (0-8)
  • Chain 'O':
    Compound: nucleoprotein
    Species: H7N9 subtype, synthetic [TaxId:333278]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NQV (0-8)
  • Chain 'P':
    Compound: nucleoprotein
    Species: H7N9 subtype, synthetic [TaxId:333278]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NQV (0-8)
  • Chain 'Q':
    Compound: nucleoprotein
    Species: H7N9 subtype, synthetic [TaxId:333278]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NQV (0-8)
  • Chain 'R':
    Compound: nucleoprotein
    Species: H7N9 subtype, synthetic [TaxId:333278]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NQV (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4nqvE (E:)
    gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqkmeprapwieqegpeyw
    dqetrnmkahsqtdranlgtlrgyynqsedgshtiqimygcdvgpdgrflrgyrqdaydg
    kdyialnedlrswtaadmaaqitkrkweavhaaeqrrvylegrcvdglrrylengketlq
    rtdppkthmthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgt
    fqkwaavvvpsgeeqrytchvqheglpkpltlrw
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.