PDB entry 4nqg

View 4nqg on RCSB PDB site
Description: Crystal Structure of Ca(2+)-regulated photoprotein mitrocomin from Jellyfish Mitrocoma cellularia at 1.3 Angstrom resolution
Class: luminescent protein
Keywords: Photoprotein, luminescent protein, bioluminescence, calcium binding, EF-hand
Deposited on 2013-11-25, released 2014-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.162
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitrocomin
    Species: Mitrocoma cellularia [TaxId:31874]
    Gene: MI17
    Database cross-references and differences (RAF-indexed):
    • PDB 4NQG (0-196)
    Domains in SCOPe 2.07: d4nqga_
  • Chain 'B':
    Compound: Mitrocomin
    Species: Mitrocoma cellularia [TaxId:31874]
    Gene: MI17
    Database cross-references and differences (RAF-indexed):
    • PDB 4NQG (0-196)
    Domains in SCOPe 2.07: d4nqgb_
  • Heterogens: CZH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4nqgA (A:)
    smgsryavkldtdfdnpkwiarhkhmfnfldinsngqinlnemvhkasniickklgatee
    qtrrhqkcvedffggagleydkdttwpeyiegwkrlaktelerhsknrvtlirlwgdalf
    diidkdgngsvsldewiqythcagiqqsrgqceatfahcdldgdgkldvdemtrqhlgfw
    ysvdstceglyggavpy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4nqgB (B:)
    smgsryavkldtdfdnpkwiarhkhmfnfldinsngqinlnemvhkasniickklgatee
    qtrrhqkcvedffggagleydkdttwpeyiegwkrlaktelerhsknrvtlirlwgdalf
    diidkdgngsvsldewiqythcagiqqsrgqceatfahcdldgdgkldvdemtrqhlgfw
    ysvdstceglyggavpy