PDB entry 4npw

View 4npw on RCSB PDB site
Description: Crystal structure of human PDE1B bound to inhibitor 19A (7,8-dimethoxy-N-[(2S)-1-(3-methyl-1H-pyrazol-5-yl)propan-2-yl]quinazolin-4-amine)
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-11-22, released 2014-07-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE1B, PDE1B1, PDES1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4npwa_
  • Heterogens: ZN, MG, 0NY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4npwA (A:)
    gsmtytsvgptystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfk
    iptvflmsfldaletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiif
    aaaihdyehtgttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkd
    efvelralviemvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqw
    lvhsrwtkalmeeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltd
    vaeksvqpladedsksknqpsfqwrqpsldvevgdpnpdvvsfrstwvkriqenkqkwke
    raasgitnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4npwA (A:)
    ystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfkiptvflmsfld
    aletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiifaaaihdyehtg
    ttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkdefvelralvie
    mvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqwlvhsrwtkalm
    eeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltdvaeksvqvvsf
    rstwvkriqenkqkwkeraas