PDB entry 4npt

View 4npt on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease Multiple Mutant P51 Complexed with Darunavir
Class: hydrolase
Keywords: HIV-1 protease, darunavir, P51, multiple mutant, drug resistance, Hydrolase
Deposited on 2013-11-22, released 2014-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.191
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot O38896 (0-98)
      • engineered mutation (6)
      • engineered mutation (24)
      • engineered mutation (31-32)
      • engineered mutation (36)
      • engineered mutation (53)
      • engineered mutation (66)
      • engineered mutation (69)
      • engineered mutation (81)
      • engineered mutation (83)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d4npta_
  • Heterogens: 017, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4nptA (A:)
    pqitlwkrpivtikvggqlrealintgaddtifeeislpgrwkpkliggiggfmkvrqyd
    qipieiaghkaigtvlvgptpinvigrnmltqigatlnf