PDB entry 4npr

View 4npr on RCSB PDB site
Description: Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus
Class: hydrolase
Keywords: b-jelly roll, xyloglucan-specific endo-beta-1,4-glucanase, HYDROLASE
Deposited on 2013-11-22, released 2014-12-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xyloglucan-specific endo-beta-1,4-glucanase GH12
    Species: Aspergillus niveus [TaxId:41281]
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6TQN1 (23-242)
      • expression tag (22)
    Domains in SCOPe 2.06: d4npra1, d4npra2
  • Chain 'B':
    Compound: Xyloglucan-specific endo-beta-1,4-glucanase GH12
    Species: Aspergillus niveus [TaxId:41281]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nprb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nprA (A:)
    mgsshhhhhhssglvprgshmasatqfcdqwgsvtegnyilynnlwgqaqatsgsqcttf
    eslsgntivwntkwswsggqgqvksfanaalqftpkklssvksidstwkwnysgsnivad
    vaydmflstspggdhnyeimvwlgalggagpisstgspiatptvagikfnlylgpngsmq
    vysfvaqsttnsfsgdmrdfftylesnqglssdlylvdvqagtepfsgsnavftvsdysv
    sva
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nprA (A:)
    satqfcdqwgsvtegnyilynnlwgqaqatsgsqcttfeslsgntivwntkwswsggqgq
    vksfanaalqftpkklssvksidstwkwnysgsnivadvaydmflstspggdhnyeimvw
    lgalggagpisstgspiatptvagikfnlylgpngsmqvysfvaqsttnsfsgdmrdfft
    ylesnqglssdlylvdvqagtepfsgsnavftvsdysvsva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nprB (B:)
    mgsshhhhhhssglvprgshmasatqfcdqwgsvtegnyilynnlwgqaqatsgsqcttf
    eslsgntivwntkwswsggqgqvksfanaalqftpkklssvksidstwkwnysgsnivad
    vaydmflstspggdhnyeimvwlgalggagpisstgspiatptvagikfnlylgpngsmq
    vysfvaqsttnsfsgdmrdfftylesnqglssdlylvdvqagtepfsgsnavftvsdysv
    sva
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nprB (B:)
    tqfcdqwgsvtegnyilynnlwgqaqatsgsqcttfeslsgntivwntkwswsggqgqvk
    sfanaalqftpkklssvksidstwkwnysgsnivadvaydmflstspggdhnyeimvwlg
    alggagpisstgspiatptvagikfnlylgpngsmqvysfvaqsttnsfsgdmrdfftyl
    esnqglssdlylvdvqagtepfsgsnavftvsdysvsva