PDB entry 4npd

View 4npd on RCSB PDB site
Description: High-resolution structure of C domain of staphylococcal protein A at cryogenic temperature
Class: protein binding
Keywords: SpA, three-helix bundle, conformational heterogeneity, rapidly unfolding and folding, RUF, antibody binding, antibody, TNFR1, von Willebrand factor, PROTEIN BINDING
Deposited on 2013-11-21, released 2014-10-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 0.9 Å
R-factor: N/A
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein A
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Gene: protein A, spa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4npda_
  • Heterogens: ZN, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4npdA (A:)
    adnkfnkeqqnafyeilhlpnlteeqrngfiqslkddpsvskeilaeakklndaqapk