PDB entry 4npc

View 4npc on RCSB PDB site
Description: Crystal Structure of an Oxidoreductase, Short-Chain Dehydrogenase/Reductase Family Protein from Brucella suis
Class: Oxidoreductase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, reductase, short-chain dehydrogenase, Oxidoreductase
Deposited on 2013-11-21, released 2013-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.151
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sorbitol dehydrogenase
    Species: Brucella suis [TaxId:470137]
    Gene: polS, BSUIS_A1688
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4npca_
  • Chain 'B':
    Compound: sorbitol dehydrogenase
    Species: Brucella suis [TaxId:470137]
    Gene: polS, BSUIS_A1688
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4npcb_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4npcA (A:)
    mahhhhhhmsdqapqidlnfplsekvaivtggasgigaaiskafiakgakvavldisadi
    akakaeelgenakpfvcdvssqqsvndaitavisqfgkidiavnsagvvylapaedisld
    ywdktininlkgsflvtqavgramiaagnggkiinlasqagtvaieehvaycaskfgvig
    msktfaaewgkygicvntlsptivltelgkkawagekgeaakkripagrfaypeeiaaaa
    vflasagadmitgadllidggytil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4npcA (A:)
    qidlnfplsekvaivtggasgigaaiskafiakgakvavldisadiakakaeelgenakp
    fvcdvssqqsvndaitavisqfgkidiavnsagvvylapaedisldywdktininlkgsf
    lvtqavgramiaagnggkiinlasqagtvaieehvaycaskfgvigmsktfaaewgkygi
    cvntlsptivltelgkkawagekgeaakkripagrfaypeeiaaaavflasagadmitga
    dllidggytil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4npcB (B:)
    mahhhhhhmsdqapqidlnfplsekvaivtggasgigaaiskafiakgakvavldisadi
    akakaeelgenakpfvcdvssqqsvndaitavisqfgkidiavnsagvvylapaedisld
    ywdktininlkgsflvtqavgramiaagnggkiinlasqagtvaieehvaycaskfgvig
    msktfaaewgkygicvntlsptivltelgkkawagekgeaakkripagrfaypeeiaaaa
    vflasagadmitgadllidggytil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4npcB (B:)
    apqidlnfplsekvaivtggasgigaaiskafiakgakvavldisadiakakaeelgena
    kpfvcdvssqqsvndaitavisqfgkidiavnsagvvylapaedisldywdktininlkg
    sflvtqavgramiaagnggkiinlasqagtvaieehvaycaskfgvigmsktfaaewgky
    gicvntlsptivltelgkkawagekgeaakkripagrfaypeeiaaaavflasagadmit
    gadllidggytil