PDB entry 4np9

View 4np9 on RCSB PDB site
Description: Structure of Rabphilin C2A domain bound to IP3
Class: protein transport
Keywords: RABPHILIN-3A, C2 DOMAIN, C2A, CALCIUM BINDING, SYNAPTIC EXOCYTOSIS METAL-BINDING, PROTEIN TRANSPORT, C-2 domain fold, EXOPHILIN-1
Deposited on 2013-11-21, released 2013-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.211
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rabphilin-3a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rph3a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4np9a_
  • Heterogens: I3P, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4np9A (A:)
    dqattlgalefsllydqdnsnlqctiirakglkpmdsngladpyvklhllpgasksnklr
    tktlrntrnpvwnetlqyhgiteedmqrktlrisvcdedkfghnefigetrfslkklkan
    qrknfniclervi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4np9A (A:)
    tlgalefsllydqdnsnlqctiirakglkpmdsngladpyvklhllpgasksnklrtktl
    rntrnpvwnetlqyhgiteedmqrktlrisvcdedkfghnefigetrfslkklkanqrkn
    fniclervi