PDB entry 4np7

View 4np7 on RCSB PDB site
Description: Structure of phosphotriesterase mutant (S308L/Y309A) from Agrobacterium radiobacter with diethyl thiophosphate bound in the active site
Class: Hydrolase
Keywords: Phosphotriesterase, Hydrolase
Deposited on 2013-11-20, released 2014-09-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.208
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: opdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93LD7 (0-328)
      • conflict (59)
      • conflict (232)
      • engineered mutation (275-276)
    Domains in SCOPe 2.06: d4np7a_
  • Heterogens: FE2, CO, DPJ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4np7A (A:)
tgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrhara
agvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflr
eiqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqq
aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegdasalalf
gtrswqtrallikalidrgykdrilvshdwlfgfslavtnimdvmdrinpdgmafvplrv
ipflrekgvppetlagvtvanparflspt