PDB entry 4np7

View 4np7 on RCSB PDB site
Description: Structure of phosphotriesterase mutant (S308L/Y309A) from Agrobacterium radiobacter with diethyl thiophosphate bound in the active site
Class: hydrolase
Keywords: Phosphotriesterase, Hydrolase
Deposited on 2013-11-20, released 2014-09-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: opdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93LD7 (0-328)
      • conflict (59)
      • conflict (232)
      • engineered mutation (275-276)
    Domains in SCOPe 2.08: d4np7a_
  • Heterogens: FE2, CO, DPJ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4np7A (A:)
    tgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrhara
    agvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflr
    eiqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqq
    aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegdasalalf
    gtrswqtrallikalidrgykdrilvshdwlfgfslavtnimdvmdrinpdgmafvplrv
    ipflrekgvppetlagvtvanparflspt