PDB entry 4np4

View 4np4 on RCSB PDB site
Description: Clostridium difficile toxin B CROP domain in complex with FAB domains of neutralizing antibody bezlotoxumab
Class: immune system
Keywords: bezlotoxumab, human antibody, FAB, CROP domain, cytotoxin, short repeat, long repeat, TcdB, receptor binding, IMMUNE SYSTEM
Deposited on 2013-11-20, released 2014-05-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: 0.199
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: toxin b
  Species: Clostridium difficile [TaxId:1496]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P18177 (1-266)
    • expression tag (267-271)
• Chain 'H':
  Compound: bezlotoxumab heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4NP4 (0-End)
• Chain 'I':
  Compound: bezlotoxumab heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4NP4 (0-End)
• Chain 'L':
  Compound: bezlotoxumab light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4NP4 (0-End)
• Chain 'M':
  Compound: bezlotoxumab light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4NP4 (0-End)
  Domains in SCOPe 2.04: d4np4m1, d4np4m2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  Sequence, based on SEQRES records: (download)
  

  >4np4M (M:)
  eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
  drfsgsgsgtdftltisrlepedfavyycqqygsstwtfgqgtkveikrtvaapsvfifp
  psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
  tlskadyekhkvyacevthqglsspvtksfnrgec
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4np4M (M:)
  eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
  drfsgsgsgtdftltisrlepedfavyycqqygsstwtfgqgtkveikrtvaapsvfifp
  psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
  tlskadyekhkvyacevthqglsspvtksfnrg