PDB entry 4np3

View 4np3 on RCSB PDB site
Description: Crystal structure of the murine cd44 hyaluronan binding domain complex with a small molecule
Class: Cell adhesion/inhibitor
Keywords: Link module, Cell surface receptor, Hyaluronan, non-glycosylated, Cell surface, Cell adhesion-inhibitor complex
Deposited on 2013-11-20, released 2014-04-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: CD44 antigen
  Species: Mus musculus [TaxId:10090]
  Gene: Cd44, Cd44 Ly-24, Ly-24
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15379 (1-149)
    • expression tag (0)
  Domains in SCOPe 2.08: d4np3a1, d4np3a2
• Heterogens: 2L2, DMS, MES, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4np3A (A:)
  nqidlnvtcryagvfhvekngrysisrteaadlcqafnstlptmdqmklalskgfetcry
  gfiegnvviprihpnaicaanhtgvyilvtsntshydtycfnasappeedctsvtdlpns
  fdgpvtitivnrdgtryskkgeyrthqedi