PDB entry 4noy

View 4noy on RCSB PDB site
Description: Crystal structure of Listeria monocytogenes Hfq F43W
Class: RNA binding protein
Keywords: LSm/Sm proteins, RNA chaperone, RNA BINDING PROTEIN
Deposited on 2013-11-20, released 2014-09-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.23
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8DG33 (0-End)
      • engineered mutation (42)
    Domains in SCOPe 2.06: d4noya_
  • Chain 'B':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8DG33
      • engineered mutation (42)
    Domains in SCOPe 2.06: d4noyb_
  • Chain 'C':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8DG33
      • engineered mutation (42)
    Domains in SCOPe 2.06: d4noyc_
  • Chain 'D':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8DG33
      • engineered mutation (42)
    Domains in SCOPe 2.06: d4noyd_
  • Chain 'E':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8DG33 (0-End)
      • engineered mutation (42)
    Domains in SCOPe 2.06: d4noye_
  • Chain 'F':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8DG33 (0-End)
      • engineered mutation (42)
    Domains in SCOPe 2.06: d4noyf_
  • Heterogens: PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4noyA (A:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnwtvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4noyA (A:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnwtvlldvegkqqlvfkha
    istfspqknvaln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4noyB (B:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnwtvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4noyB (B:)
    kqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnwtvlldvegkqqlvfkhai
    stfspqknval
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4noyC (C:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnwtvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4noyC (C:)
    kqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnwtvlldvegkqqlvfkhai
    stfspqknvalnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4noyD (D:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnwtvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4noyD (D:)
    qggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnwtvlldvegkqqlvfkhais
    tfspqknva
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4noyE (E:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnwtvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4noyE (E:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnwtvlldvegkqqlvfkha
    istfspqknval
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4noyF (F:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnwtvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4noyF (F:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnwtvlldvegkqqlvfkha
    istfspqknvalnpd