PDB entry 4noa

View 4noa on RCSB PDB site
Description: Truncated minor pilin PilE from Pseudomonas aeruginosa
Deposited on 2013-11-19, released 2014-11-19
The last revision was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.16
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type 4 fimbrial biogenesis protein PilE
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA4556, pilE
    Database cross-references and differences (RAF-indexed):
    • Uniprot G3XD43 (6-111)
      • expression tag (4-5)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4noaA (A:)
gidpftirsnrtegqallsdaaarqeryysqnpgvgytkdvaklgmssanspnnlynlti
atptsttytltatpinsqtrdktcgkltlnqlgergaagktgnnstvndcwr

    Sequence, based on observed residues (ATOM records):
    >4noaA (A:)
ftirsnrtegqallsdaaarqeryysqnpgvgytkdvaklgmssanspnnlynltiatpt
sttytltatpinsqtrdktcgkltlnqlgergaagktgnnstvndcwr