PDB entry 4nnp

View 4nnp on RCSB PDB site
Description: Crystal Structure of Apo Manganese ABC transporter MntC from Staphylococcus aureus bound to an antagonistic fab fragment
Class: transport protein/immune system
Keywords: ABC superfamily ATP binding cassette transporter, MntC, fab, Apo, MRSA, TRANSPORT PROTEIN-IMMUNE SYSTEM complex
Deposited on 2013-11-18, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein
    Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
    Gene: SAV0631
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nnpa_
  • Chain 'B':
    Compound: Lipoprotein
    Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
    Gene: SAV0631
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nnpb_
  • Chain 'H':
    Compound: Heavy chain of antagonistic fab fragment
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4NNP
  • Chain 'L':
    Compound: Light chain of antagonistic fab fragment
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4NNP
    Domains in SCOPe 2.07: d4nnpl1, d4nnpl2
  • Chain 'X':
    Compound: Heavy chain of antagonistic fab fragment
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4NNP
  • Chain 'Y':
    Compound: Light chain of antagonistic fab fragment
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4NNP
    Domains in SCOPe 2.07: d4nnpy1, d4nnpy2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nnpA (A:)
    gtggkqssdksngklkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikk
    ltdadvilynglnletgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkqd
    phawlsldngikyvktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipke
    qramitsegafkyfskqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsv
    dkkameslseetkkdifgevytdsigkegtkgdsyykmmksnietvhgsmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nnpA (A:)
    klkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilyngln
    letgngwfekaleqagkslkdkkviavskdvkpiylneegnkdkqdphawlsldngikyv
    ktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafkyf
    skqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseeifg
    evytdsigkegtkgdsyykmmksnietvhgsmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nnpB (B:)
    gtggkqssdksngklkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikk
    ltdadvilynglnletgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkqd
    phawlsldngikyvktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipke
    qramitsegafkyfskqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsv
    dkkameslseetkkdifgevytdsigkegtkgdsyykmmksnietvhgsmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nnpB (B:)
    klkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilyngln
    letgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkqdphawlsldngiky
    vktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafky
    fskqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseetf
    gevytdsigkegtkgdsyykmmksnietvhgsmk
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4nnpL (L:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqsyysspftfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nnpL (L:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqsyysspftfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >4nnpY (Y:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqsyysspftfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nnpY (Y:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqsyysspftfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg