PDB entry 4nnm

View 4nnm on RCSB PDB site
Description: Tax-Interacting Protein-1 (TIP-1) PDZ domain bound to Y-iCAL36 (YPTSII) peptide
Class: protein binding
Keywords: Tax-Interacting Protein-1, TIP-1, PDZ, PDZ-peptide, PROTEIN BINDING
Deposited on 2013-11-18, released 2015-01-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.207
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tax1-binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TAX1BP3, TIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4nnma_
  • Chain 'B':
    Compound: tax1-binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TAX1BP3, TIP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14907 (1-111)
      • expression tag (0)
    Domains in SCOPe 2.08: d4nnmb1, d4nnmb2
  • Chain 'C':
    Compound: TIP-1 PDZ domain
    Database cross-references and differences (RAF-indexed):
    • PDB 4NNM (0-5)
  • Chain 'D':
    Compound: TIP-1 PDZ domain
    Database cross-references and differences (RAF-indexed):
    • PDB 4NNM (0-5)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4nnmA (A:)
vtavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaei
aglqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrqslqkavqq

    Sequence, based on observed residues (ATOM records): (download) 
    >4nnmA (A:)
tavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeia
glqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrqslqkavqq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4nnmB (B:)
vtavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaei
aglqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrqslqkavqq

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.