PDB entry 4nnj

View 4nnj on RCSB PDB site
Description: Crystal structure of Uba1 in complex with ubiquitin-AMP and thioesterified ubiquitin
Class: protein binding
Keywords: ubiquitin activating enzyme (E1), Uba1, ubiquitin, acyladenylate, ubiquitin thioester, Ubiquitin activation, AMP, thioesterified Ub, PROTEIN BINDING
Deposited on 2013-11-18, released 2014-05-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.164
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: UBA1, YKL210W
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uba1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SCD2, UBI4, YLL039C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG63 (3-78)
      • expression tag (1-2)
    Domains in SCOPe 2.04: d4nnjb_
  • Chain 'C':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: UBA1, YKL210W
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Uba1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SCD2, UBI4, YLL039C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG63 (3-78)
      • expression tag (2)
  • Chain 'E':
    Compound: Uba1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SCD2, UBI4, YLL039C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG63 (3-78)
      • expression tag (2)
  • Heterogens: SO4, GOL, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nnjB (B:)
    saamqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtls
    dyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nnjB (B:)
    aamqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsd
    yniqkestlhlvlrlrgg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.