PDB entry 4nn9

View 4nn9 on RCSB PDB site
Description: refined atomic structures of n9 subtype influenza virus neuraminidase and escape mutants
Deposited on 1991-03-28, released 1992-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.163
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d4nn9__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4nn9_ (-)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisrasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl