PDB entry 4nla

View 4nla on RCSB PDB site
Description: Structure of the central NEAT domain, N2, of the listerial Hbp2 protein, apo form
Class: protein binding
Keywords: Heme, NEAT domain, listeria, hemoglobin, N2, Hbp, Hbp2, HEME-BINDING PROTEIN, PROTEIN BINDING, HEME BINDING
Deposited on 2013-11-14, released 2014-10-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-31, with a file datestamp of 2014-12-26.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.258
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Iron-regulated surface determinant protein A
  Species: Listeria monocytogenes [TaxId:1639]
  Gene: BN418_2635, lmo2185, M639_06195
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KGV9 (1-121)
    • expression tag (0)
  Domains in SCOPe 2.08: d4nlaa1, d4nlaa2
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nlaA (A:)
  stlsdgiytipfvakkanddsnssmqnyfnnpawlkvkngkkmvamtvndnktvtalktt
  lagtlqdvkvvsedkdantrivefevedlnqplaahvnyeapfngsvykgqadfryvfdt
  ak