PDB entry 4nl3

View 4nl3 on RCSB PDB site
Description: Crystal Structure of Listeria monocytogenes Hfq in complex with U6 RNA
Class: RNA binding protein/RNA
Keywords: LSm/Sm proteins, RNA chaperone, sRNA, RNA BINDING PROTEIN-RNA complex
Deposited on 2013-11-13, released 2014-09-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.224
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nl3a_
  • Chain 'B':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nl3b_
  • Chain 'C':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nl3c_
  • Chain 'D':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nl3d_
  • Chain 'E':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nl3e_
  • Chain 'F':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nl3f_
  • Chain 'G':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nl3g_
  • Chain 'H':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nl3h_
  • Chain 'I':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nl3i_
  • Chain 'J':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nl3j_
  • Chain 'K':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nl3k_
  • Chain 'L':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nl3l_
  • Chain 'R':
    Compound: 5'-r(*up*up*up*up*up*u)-3'
  • Chain 'Z':
    Compound: 5'-r(*up*up*up*up*up*u)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nl3A (A:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl3A (A:)
    kqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkhai
    stfspqknvaln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nl3B (B:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl3B (B:)
    kqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkhai
    stfspqknval
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nl3C (C:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl3C (C:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nl3D (D:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl3D (D:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvaln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4nl3E (E:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl3E (E:)
    kqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkhai
    stfspqknvaln
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4nl3F (F:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl3F (F:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4nl3G (G:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl3G (G:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvaln
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4nl3H (H:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl3H (H:)
    kqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkhai
    stfspqknval
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4nl3I (I:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl3I (I:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4nl3J (J:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl3J (J:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvaln
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4nl3K (K:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl3K (K:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvaln
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4nl3L (L:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl3L (L:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnp
    

  • Chain 'R':
    No sequence available.

  • Chain 'Z':
    No sequence available.