PDB entry 4nl2

View 4nl2 on RCSB PDB site
Description: Crystal Structure of Listeria monocytogenes Hfq
Class: RNA binding protein
Keywords: LSm/Sm proteins, RNA chaperone, RNA BINDING PROTEIN
Deposited on 2013-11-13, released 2014-09-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nl2a_
  • Chain 'B':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nl2b_
  • Chain 'C':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nl2c_
  • Chain 'D':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nl2d_
  • Chain 'E':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nl2e_
  • Chain 'F':
    Compound: Protein hfq
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hfq, LMHCC_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nl2f_
  • Heterogens: PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nl2A (A:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl2A (A:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvaln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nl2B (B:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl2B (B:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknval
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nl2C (C:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl2C (C:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nl2D (D:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl2D (D:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvaln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4nl2E (E:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl2E (E:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvaln
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4nl2F (F:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl2F (F:)
    mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
    istfspqknvalnpd