PDB entry 4nkz

View 4nkz on RCSB PDB site
Description: Human steroidogenic cytochrome P450 17A1 mutant A105L with substrate 17alpha-hydroxypregnenolone
Deposited on 2013-11-13, released 2014-10-22
The last revision was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.194
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Steroid 17-alpha-hydroxylase/17,20 lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP17, CYP17A1, S17AH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05093
      • engineered mutation (86)
  • Chain 'B':
    Compound: Steroid 17-alpha-hydroxylase/17,20 lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP17, CYP17A1, S17AH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05093
      • engineered mutation (86)
  • Chain 'C':
    Compound: Steroid 17-alpha-hydroxylase/17,20 lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP17, CYP17A1, S17AH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05093
      • engineered mutation (86)
  • Chain 'D':
    Compound: Steroid 17-alpha-hydroxylase/17,20 lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP17, CYP17A1, S17AH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05093
      • engineered mutation (86)
  • Heterogens: HEM, LZZ, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4nkzA (A:)
    makktgakypksllslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivgh
    hqlakevlikkgkdfsgrpqmatldilsnnrkgiafadsgahwqlhrrlamatfalfkdg
    dqklekiicqeistlcdmlathngqsidisfpvfvavtnvislicfntsykngdpelnvi
    qnynegiidnlskdslvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsds
    itnmldtlmqakmnsdngnagpdqdsellsdnhilttigdifgagvetttsvvkwtlafl
    lhnpqvkkklyeeidqnvgfsrtptisdrnrlllleatirevlrlrpvapmliphkanvd
    ssigefavdkgteviinlwalhhnekewhqpdqfmperflnpagtqlispsvsylpfgag
    prscigeilarqelflimawllqrfdlevpddgqlpslegipkvvflidsfkvkikvrqa
    wreaqaegsthhhh
    

    Sequence, based on observed residues (ATOM records):
    >4nkzA (A:)
    llslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivghhqlakevlikkg
    kdfsgrpqmatldilsnnrkgiafadsgahwqlhrrlamatfalfkdqklekiicqeist
    lcdmlathngqsidisfpvfvavtnvislicfntsykngdpelnviqnynegiidnlskd
    slvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsdsitnmldtlmqakmn
    sdsellsdnhilttigdifgagvetttsvvkwtlafllhnpqvkkklyeeidqnvgfsrt
    ptisdrnrlllleatirevlrlrpvapmliphkanvdssigefavdkgteviinlwalhh
    nekewhqpdqfmperflnpagtqlispsvsylpfgagprscigeilarqelflimawllq
    rfdlevpddgqlpslegipkvvflidsfkvkikvrqawreaqa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4nkzB (B:)
    makktgakypksllslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivgh
    hqlakevlikkgkdfsgrpqmatldilsnnrkgiafadsgahwqlhrrlamatfalfkdg
    dqklekiicqeistlcdmlathngqsidisfpvfvavtnvislicfntsykngdpelnvi
    qnynegiidnlskdslvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsds
    itnmldtlmqakmnsdngnagpdqdsellsdnhilttigdifgagvetttsvvkwtlafl
    lhnpqvkkklyeeidqnvgfsrtptisdrnrlllleatirevlrlrpvapmliphkanvd
    ssigefavdkgteviinlwalhhnekewhqpdqfmperflnpagtqlispsvsylpfgag
    prscigeilarqelflimawllqrfdlevpddgqlpslegipkvvflidsfkvkikvrqa
    wreaqaegsthhhh
    

    Sequence, based on observed residues (ATOM records):
    >4nkzB (B:)
    llslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivghhqlakevlikkg
    kdfsgrpqmatldilsnnrkgiafadsgahwqlhrrlamatfalfkdklekiicqeistl
    cdmlathngqsidisfpvfvavtnvislicfntsykngdpelnviqnynegiidnlskds
    lvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsdsitnmldtlmqakmns
    dsellsdnhilttigdifgagvetttsvvkwtlafllhnpqvkkklyeeidqnvgfsrtp
    tisdrnrlllleatirevlrlrpvapmliphkanvdssigefavdkgteviinlwalhhn
    ekewhqpdqfmperflnpagtqlispsvsylpfgagprscigeilarqelflimawllqr
    fdlevpddgqlpslegipkvvflidsfkvkikvrqawreaq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >4nkzC (C:)
    makktgakypksllslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivgh
    hqlakevlikkgkdfsgrpqmatldilsnnrkgiafadsgahwqlhrrlamatfalfkdg
    dqklekiicqeistlcdmlathngqsidisfpvfvavtnvislicfntsykngdpelnvi
    qnynegiidnlskdslvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsds
    itnmldtlmqakmnsdngnagpdqdsellsdnhilttigdifgagvetttsvvkwtlafl
    lhnpqvkkklyeeidqnvgfsrtptisdrnrlllleatirevlrlrpvapmliphkanvd
    ssigefavdkgteviinlwalhhnekewhqpdqfmperflnpagtqlispsvsylpfgag
    prscigeilarqelflimawllqrfdlevpddgqlpslegipkvvflidsfkvkikvrqa
    wreaqaegsthhhh
    

    Sequence, based on observed residues (ATOM records):
    >4nkzC (C:)
    llslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivghhqlakevlikkg
    kdfsgrpqmatldilsnnrkgiafadsgahwqlhrrlamatfalfkqklekiicqeistl
    cdmlathngqsidisfpvfvavtnvislicfntsykngdpelnviqnynegiidnlskds
    lvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsdsitnmldtlmqakmns
    dnqdsellsdnhilttigdifgagvetttsvvkwtlafllhnpqvkkklyeeidqnvgfs
    rtptisdrnrlllleatirevlrlrpvapmliphkanvdssigefavdkgteviinlwal
    hhnekewhqpdqfmperflnpagtqlispsvsylpfgagprscigeilarqelflimawl
    lqrfdlevpddgqlpslegipkvvflidsfkvkikvrqawreaq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >4nkzD (D:)
    makktgakypksllslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivgh
    hqlakevlikkgkdfsgrpqmatldilsnnrkgiafadsgahwqlhrrlamatfalfkdg
    dqklekiicqeistlcdmlathngqsidisfpvfvavtnvislicfntsykngdpelnvi
    qnynegiidnlskdslvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsds
    itnmldtlmqakmnsdngnagpdqdsellsdnhilttigdifgagvetttsvvkwtlafl
    lhnpqvkkklyeeidqnvgfsrtptisdrnrlllleatirevlrlrpvapmliphkanvd
    ssigefavdkgteviinlwalhhnekewhqpdqfmperflnpagtqlispsvsylpfgag
    prscigeilarqelflimawllqrfdlevpddgqlpslegipkvvflidsfkvkikvrqa
    wreaqaegsthhhh
    

    Sequence, based on observed residues (ATOM records):
    >4nkzD (D:)
    llslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivghhqlakevlikkg
    kdfsgrpqmatldilsnnrkgiafadsgahwqlhrrlamatfalfkdgdqklekiicqei
    stlcdmlathngqsidisfpvfvavtnvislicfntsykngdpelnviqnynegiidnls
    kdslvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsdsitnmldtlmqak
    mnsddsellsdnhilttigdifgagvetttsvvkwtlafllhnpqvkkklyeeidqnvgf
    srtptisdrnrlllleatirevlrlrpvapmliphkanvdssigefavdkgteviinlwa
    lhhnekewhqpdqfmperflnpagtqlispsvsylpfgagprscigeilarqelflimaw
    llqrfdlevpddgqlpslegipkvvflidsfkvkikvrqawreaq