PDB entry 4nkk

View 4nkk on RCSB PDB site
Description: Crystal structure of a multi-drug resistant clinical isolate-769 HIV-1 protease variant that is resistant to the dimerization inhibitory activity of TLF-PafF
Class: hydrolase
Keywords: HIV, AIDS, HIV-1 protease, dimerization inhibitors, protease inhibitors, multidrug-resistance, clinical isolate 769, dimer protease, Hydrolase
Deposited on 2013-11-12, released 2014-07-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-08-20, with a file datestamp of 2014-08-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q000H7 (0-98)
      • engineered mutation (9)
      • engineered mutation (24)
      • see remark 999 (34-35)
      • see remark 999 (45)
      • see remark 999 (81)
    Domains in SCOPe 2.08: d4nkka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4nkkA (A:)
    pqitlwqrpvvtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf