PDB entry 4nj8

View 4nj8 on RCSB PDB site
Description: crystal structure of the human anks3 sam domain l52a mutant
Deposited on 2013-11-08, released 2014-07-16
The last revision was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ankyrin repeat and SAM domain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ANKS3, KIAA1977
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ZW76 (1-End)
      • engineered mutation (51)
  • Chain 'B':
    Compound: Ankyrin repeat and SAM domain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ANKS3, KIAA1977
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ZW76
      • engineered mutation (51)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4nj8A (A:)
srapysgpqdlaalleqigclkylqvfeeqdvdlrifltltesdlkeigitafgpkrkmt
saiarwhssar

    Sequence, based on observed residues (ATOM records):
    >4nj8A (A:)
rapysgpqdlaalleqigclkylqvfeeqdvdlrifltltesdlkeigitafgpkrkmts
aiarwhs

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4nj8B (B:)
srapysgpqdlaalleqigclkylqvfeeqdvdlrifltltesdlkeigitafgpkrkmt
saiarwhssar

    Sequence, based on observed residues (ATOM records):
    >4nj8B (B:)
pqdlaalleqigclkylqvfeeqdvdlrifltltesdlkeigitafgpkrkmtsaiarwh
ssa