PDB entry 4nj0

View 4nj0 on RCSB PDB site
Description: GCN4-p1 single Val9 to Ile mutant
Deposited on 2013-11-08, released 2014-08-20
The last revision was dated 2014-08-20, with a file datestamp of 2014-08-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.259
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: General control protein GCN4
  Species: Saccharomyces cerevisiae, synthetic [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-End)
    • engineered mutation (8)
• Chain 'B':
  Compound: General control protein GCN4
  Species: Saccharomyces cerevisiae, synthetic [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-32)
    • engineered mutation (8)
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence, based on SEQRES records:
  

  >4nj0A (A:)
  rmkqledkieellsknyhlenevarlkklvger
  

  
  Sequence, based on observed residues (ATOM records):
  

  >4nj0A (A:)
  rmkqledkieellsknyhlenevarlkklvg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >4nj0B (B:)
  rmkqledkieellsknyhlenevarlkklvger