PDB entry 4niq

View 4niq on RCSB PDB site
Description: Crystal Structure of Vps4 MIT-Vfa1 MIM2
Class: protein transport
Keywords: cytosol, Protein transport
Deposited on 2013-11-06, released 2014-03-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vacuolar protein sorting-associated protein 4
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: CSC1, DID6, END13, GRD13, P9705.10, VPL4, VPS4, VPT10, YPR173C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P52917 (1-82)
  Domains in SCOPe 2.08: d4niqa_
• Chain 'B':
  Compound: vacuolar protein sorting-associated protein 4
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: CSC1, DID6, END13, GRD13, P9705.10, VPL4, VPS4, VPT10, YPR173C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P52917
  Domains in SCOPe 2.08: d4niqb_
• Chain 'C':
  Compound: VPS4-associated protein 1
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: SYGP-ORF44, VFA1, YER128W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40080 (1-22)
• Chain 'D':
  Compound: VPS4-associated protein 1
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: SYGP-ORF44, VFA1, YER128W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40080 (Start-22)

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4niqA (A:)
  smstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirak
  fteylnraeqlkkhleseeanaa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4niqA (A:)
  mstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirakf
  teylnraeqlkkhleseeanaa
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4niqB (B:)
  smstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirak
  fteylnraeqlkkhleseeanaa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4niqB (B:)
  gdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirakftey
  lnraeqlkkhleseeana
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.