PDB entry 4nib

View 4nib on RCSB PDB site
Description: crystal structure of human insulin mutant b20 d-ala, b23 d-ala
Deposited on 2013-11-05, released 2014-08-27
The last revision was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin A chain
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'B':
  Compound: insulin B chain
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered mutation (19)
    • engineered mutation (22)
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >4nibA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >4nibB (B:)
  fvnqhlcgshlvealylvcaeraffytpkt