PDB entry 4ni5

View 4ni5 on RCSB PDB site
Description: Crystal Structure of a Short Chain Dehydrogenase from Brucella suis
Class: oxidoreductase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, short chain dehydrogenase, dehydrogenase, oxidoreductase
Deposited on 2013-11-05, released 2013-11-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.152
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase, short-chain dehydrogenase/reductase family protein
    Species: Brucella suis [TaxId:470137]
    Gene: BSUIS_A1171
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ni5a_
  • Chain 'B':
    Compound: Oxidoreductase, short-chain dehydrogenase/reductase family protein
    Species: Brucella suis [TaxId:470137]
    Gene: BSUIS_A1171
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ni5b_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ni5A (A:)
    mahhhhhhmrfkdkvvivtggasgigeatarafiregakvviadfsdhgqqladeragah
    eqalfiktdvadtravqaliartvenygrldimfanagiaadapideldeaawqktidin
    ltgvylcdkyaidqmrsqgggvivncgsihshvgksgvtayaaakggvklltqtlaidyg
    pqnirvnavcpgyidtpllknipddkkqalvalhpmgrlgraeevanavlflasdeasfv
    ngasllvdggytaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ni5A (A:)
    mrfkdkvvivtggasgigeatarafiregakvviadfsdalfiktdvadtravqaliart
    venygrldimfanagiaadapideldeaawqktidinltgvylcdkyaidqmrsqgggvi
    vncgsihshvgksgvtayaaakggvklltqtlaidygpqnirvnavcpgyidtpddkkqa
    lvalhpmgrlgraeevanavlflasdeasfvngasllvdggytaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ni5B (B:)
    mahhhhhhmrfkdkvvivtggasgigeatarafiregakvviadfsdhgqqladeragah
    eqalfiktdvadtravqaliartvenygrldimfanagiaadapideldeaawqktidin
    ltgvylcdkyaidqmrsqgggvivncgsihshvgksgvtayaaakggvklltqtlaidyg
    pqnirvnavcpgyidtpllknipddkkqalvalhpmgrlgraeevanavlflasdeasfv
    ngasllvdggytaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ni5B (B:)
    mrfkdkvvivtggasgigeatarafiregakvviadfsdalfiktdvadtravqaliart
    venygrldimfanagiaadapideldeaawqktidinltgvylcdkyaidqmrsqgggvi
    vncgsihshvgksgvtayaaakggvklltqtlaidygpqnirvnavcpgyidtipddkkq
    alvalhpmgrlgraeevanavlflasdeasfvngasllvdggytaq