PDB entry 4nhz

View 4nhz on RCSB PDB site
Description: Crystal structure of glutathione transferase BBTA-3750 from Bradyrhizobium sp., Target EFI-507290, with one glutathione bound
Class: transferase
Keywords: glutathione s-transferase, Enzyme Function Initiative, EFI, structural genomics, transferase
Deposited on 2013-11-05, released 2013-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nhza1, d4nhza2
  • Chain 'B':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5EI34 (22-255)
      • expression tag (12-21)
      • expression tag (12-22)
    Domains in SCOPe 2.07: d4nhzb1, d4nhzb2, d4nhzb3
  • Chain 'C':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nhzc1, d4nhzc2
  • Chain 'D':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nhzd1, d4nhzd2
  • Chain 'E':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nhze1, d4nhze2
  • Chain 'F':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nhzf1, d4nhzf2
  • Chain 'G':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nhzg1, d4nhzg2
  • Chain 'H':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5EI34 (22-255)
      • expression tag (10-21)
      • expression tag (10-22)
    Domains in SCOPe 2.07: d4nhzh1, d4nhzh2, d4nhzh3
  • Chain 'I':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nhzi1, d4nhzi2
  • Chain 'J':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nhzj1, d4nhzj2
  • Chain 'K':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nhzk1, d4nhzk2
  • Chain 'L':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nhzl1, d4nhzl2
  • Chain 'M':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nhzm1, d4nhzm2
  • Chain 'N':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nhzn1, d4nhzn2
  • Chain 'O':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nhzo1, d4nhzo2
  • Chain 'P':
    Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
    Species: Bradyrhizobium sp. [TaxId:288000]
    Gene: BBta_3750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nhzp1, d4nhzp2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nhzA (A:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzA (A:)
    dlssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpef
    lslnpngkipaiidpngpgdkplglfesgailqylaektgqflpadparrwqtlqwlhfq
    mggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldgrqwimdadytia
    diatlgwvrnligfygarelvafdelthvpawlerglarpavqrgleipkrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nhzB (B:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzB (B:)
    lgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephai
    dfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqylaektgqflpadpa
    rrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldg
    rqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerglarpavqrglei
    pkrp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nhzC (C:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzC (C:)
    sdlssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpe
    flslnpngkipaiidpngpgdkplglfesgailqylaektgqflpadparrwqtlqwlhf
    qmggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldgrqwimdadyti
    adiatlgwvrnligfygarelvafdelthvpawlerglarpavqrgleipkrp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nhzD (D:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzD (D:)
    dlssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpef
    lslnpngkipaiidpngpgdkplglfesgailqylaektgqflpadparrwqtlqwlhfq
    mggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldgrqwimdadytia
    diatlgwvrnligfygarelvafdelthvpawlerglarpavqrgleipkrp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4nhzE (E:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzE (E:)
    dlssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpef
    lslnpngkipaiidpngpgdkplglfesgailqylaektgqflpadparrwqtlqwlhfq
    mggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldgrqwimdadytia
    diatlgwvrnligfygarelvafdelthvpawlerglarpavqrgleipkrp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4nhzF (F:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzF (F:)
    lssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpefl
    slnpngkipaiidpngpgdkplglfesgailqylaektgqflpadparrwqtlqwlhfqm
    ggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldgrqwimdadytiad
    iatlgwvrnligfygarelvafdelthvpawlerglarpavqrgleipkrp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4nhzG (G:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzG (G:)
    lssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpefl
    slnpngkipaiidpngpgdkplglfesgailqylaektgqflpadparrwqtlqwlhfqm
    ggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldgrqwimdadytiad
    iatlgwvrnligfygarelvafdelthvpawlerglarpavqrgleipkrp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4nhzH (H:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzH (H:)
    vdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyeph
    aidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqylaektgqflpad
    parrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearl
    dgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerglarpavqrgl
    eipkrp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4nhzI (I:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzI (I:)
    dlssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpef
    lslnpngkipaiidpngpgdkplglfesgailqylaektgqflpadparrwqtlqwlhfq
    mggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldgrqwimdadytia
    diatlgwvrnligfygarelvafdelthvpawlerglarpavqrgleipkrp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4nhzJ (J:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzJ (J:)
    lssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpefl
    slnpngkipaiidpngpgdkplglfesgailqylaektgqflpadparrwqtlqwlhfqm
    ggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldgrqwimdadytiad
    iatlgwvrnligfygarelvafdelthvpawlerglarpavqrgleipkrp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4nhzK (K:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzK (K:)
    lssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpefl
    slnpngkipaiidpngpgdkplglfesgailqylaektgqflpadparrwqtlqwlhfqm
    ggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldgrqwimdadytiad
    iatlgwvrnligfygarelvafdelthvpawlerglarpavqrgleipkrp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4nhzL (L:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzL (L:)
    sdlssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpe
    flslnpngkipaiidpngpgdkplglfesgailqylaektgqflpadparrwqtlqwlhf
    qmggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldgrqwimdadyti
    adiatlgwvrnligfygarelvafdelthvpawlerglarpavqrgleipkrp
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4nhzM (M:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzM (M:)
    lssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpefl
    slnpngkipaiidpngpgdkplglfesgailqylaektgqflpadparrwqtlqwlhfqm
    ggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldgrqwimdadytiad
    iatlgwvrnligfygarelvafdelthvpawlerglarpavqrgleipkrp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4nhzN (N:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzN (N:)
    dlssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpef
    lslnpngkipaiidpngpgdkplglfesgailqylaektgqflpadparrwqtlqwlhfq
    mggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldgrqwimdadytia
    diatlgwvrnligfygarelvafdelthvpawlerglarpavqrgleipkrp
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4nhzO (O:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzO (O:)
    lssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpefl
    slnpngkipaiidpngpgdkplglfesgailqylaektgqflpadparrwqtlqwlhfqm
    ggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldgrqwimdadytiad
    iatlgwvrnligfygarelvafdelthvpawlerglarpavqrgleipkrp
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4nhzP (P:)
    mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
    eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
    ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
    rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
    larpavqrgleipkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhzP (P:)
    dlssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpef
    lslnpngkipaiidpngpgdkplglfesgailqylaektgqflpadparrwqtlqwlhfq
    mggigpmfgqlgffhkfagreyedkrplqryvaeskrllgvlearldgrqwimdadytia
    diatlgwvrnligfygarelvafdelthvpawlerglarpavqrgleipkrp