PDB entry 4nhj

View 4nhj on RCSB PDB site
Description: Crystal structure of Klebsiella pneumoniae RstA DNA-binding domain in complex with RstA box
Class: transcription regulator/DNA
Keywords: Two-Component System, response regulator, TRANSCRIPTION REGULATOR-DNA complex
Deposited on 2013-11-05, released 2014-07-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding transcriptional regulator RstA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: rstA, KPN2242_10390, KPR_2822
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0GNT0
      • engineered mutation (32)
      • engineered mutation (47)
    Domains in SCOPe 2.08: d4nhja_
  • Chain 'B':
    Compound: DNA-binding transcriptional regulator RstA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: rstA, KPN2242_10390, KPR_2822
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0GNT0
      • engineered mutation (32)
      • engineered mutation (47)
    Domains in SCOPe 2.08: d4nhjb_
  • Chain 'C':
    Compound: 5'-d(*gp*gp*tp*tp*gp*tp*ap*cp*ap*tp*tp*cp*cp*gp*tp*tp*ap*cp*tp*cp*cp*cp*t)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*ap*gp*gp*gp*ap*gp*tp*ap*ap*cp*gp*gp*ap*ap*tp*gp*tp*ap*cp*ap*ap*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nhjA (A:)
    mhhhhhhamgtltphktisfgsltidpvnrqvmlggenvalstadfdmlwelathagqim
    drdallknlrgvtydgmdrsvdvaisrlrkklldnatepyriktvrnkgylfaphawdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhjA (A:)
    phktisfgsltidpvnrqvmlggenvalstadfdmlwelathagqimdrdallknlrgvt
    ydgmdrsvdvaisrlrkklldnatepyriktvrnkgylfaph
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nhjB (B:)
    mhhhhhhamgtltphktisfgsltidpvnrqvmlggenvalstadfdmlwelathagqim
    drdallknlrgvtydgmdrsvdvaisrlrkklldnatepyriktvrnkgylfaphawdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nhjB (B:)
    hktisfgsltidpvnrqvmlggenvalstadfdmlwelathagqimdrdallknlrgvty
    dgmdrsvdvaisrlrkklldnatepyriktvrnkgylfaph
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.