PDB entry 4nft

View 4nft on RCSB PDB site
Description: Crystal structure of human lnkH2B-h2A.Z-Anp32e
Class: chaperone
Keywords: Histone binding protein, CHAPERONE
Deposited on 2013-11-01, released 2014-04-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H2B type 2-E, Histone H2A.Z
    Species: Homo sapiens [TaxId:9606]
    Gene: H2BFQ, H2AZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16778 (4-96)
      • expression tag (3)
    • Uniprot P0C0S5 (97-End)
    Domains in SCOPe 2.06: d4nfta1, d4nfta2, d4nfta3
  • Chain 'B':
    Compound: Histone H2B type 2-E, Histone H2A.Z
    Species: Homo sapiens [TaxId:9606]
    Gene: H2BFQ, H2AZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16778 (4-96)
      • expression tag (3)
    • Uniprot P0C0S5 (97-End)
    Domains in SCOPe 2.06: d4nftb1, d4nftb2, d4nftb3
  • Chain 'C':
    Compound: Histone H2B type 2-E, Histone H2A.Z
    Species: Homo sapiens [TaxId:9606]
    Gene: H2BFQ, H2AZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nftc1, d4nftc2
  • Chain 'D':
    Compound: Histone H2B type 2-E, Histone H2A.Z
    Species: Homo sapiens [TaxId:9606]
    Gene: H2BFQ, H2AZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nftd1, d4nftd2
  • Chain 'E':
    Compound: acidic leucine-rich nuclear phosphoprotein 32 family member e
    Species: Homo sapiens [TaxId:9606]
    Gene: ANP32E
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: acidic leucine-rich nuclear phosphoprotein 32 family member e
    Species: Homo sapiens [TaxId:9606]
    Gene: ANP32E
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nftA (A:)
    gshmrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrst
    itsreiqtavrlllpgelakhavsegtkavtkytsskkavsrsqraglqfpvgrihrhlk
    srttshgrvgataavysaaileyltaevlelagnaskdlkvkritprhlqlairgdeeld
    slikatiagggviphisgsggsggglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nftA (A:)
    mrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstits
    reiqtavrlllpgelakhavsegtkavtkytsskksrsqraglqfpvgrihrhlksrtts
    hgrvgataavysaaileyltaevlelagnaskdlkvkritprhlqlairgdeeldslika
    tiag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nftB (B:)
    gshmrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrst
    itsreiqtavrlllpgelakhavsegtkavtkytsskkavsrsqraglqfpvgrihrhlk
    srttshgrvgataavysaaileyltaevlelagnaskdlkvkritprhlqlairgdeeld
    slikatiagggviphisgsggsggglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nftB (B:)
    mrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstits
    reiqtavrlllpgelakhavsegtkavtkytsskksrsqraglqfpvgrihrhlksrtts
    hgrvgataavysaaileyltaevlelagnaskdlkvkritprhlqlairgdeeldslika
    tiag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nftC (C:)
    gshmrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrst
    itsreiqtavrlllpgelakhavsegtkavtkytsskkavsrsqraglqfpvgrihrhlk
    srttshgrvgataavysaaileyltaevlelagnaskdlkvkritprhlqlairgdeeld
    slikatiagggviphisgsggsggglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nftC (C:)
    sysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsreiq
    tavrlllpgelakhavsegtkavtkytsssrsqraglqfpvgrihrhlksrttshgrvga
    taavysaaileyltaevlelagnaskdlkvkritprhlqlairgdeeldslikatiag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nftD (D:)
    gshmrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrst
    itsreiqtavrlllpgelakhavsegtkavtkytsskkavsrsqraglqfpvgrihrhlk
    srttshgrvgataavysaaileyltaevlelagnaskdlkvkritprhlqlairgdeeld
    slikatiagggviphisgsggsggglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nftD (D:)
    sysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsreiq
    tavrlllpgelakhavsegtkavtkytsssrsqraglqfpvgrihrhlksrttshgrvga
    taavysaaileyltaevlelagnaskdlkvkritprhlqlairgdeeldslikatiag
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.