PDB entry 4nfm

View 4nfm on RCSB PDB site
Description: Human tau tubulin kinase 1 (TTBK1)
Class: transferase
Keywords: protein kinase, phosphotransferase, TRANSFERASE
Deposited on 2013-10-31, released 2014-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.206
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tau-tubulin kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TTBK1, BDTK, KIAA1855
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nfma_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nfmA (A:)
    ghmsgggeqadilpanyvvkdrwkvlkkiggggfgeiyeamdlltrenvalkvesaqqpk
    qvlkmevavlkklqgkdhvcrfigcgrnekfnyvvmqlqgrnladlrrsqprgtftlstt
    lrlgkqilesieaihsvgflhrdikpsnfamgrlpstyrkcymldfglarqytnttgdvr
    pprnvagfrgtvryasvnahknremgrhddlwslfymlvefavgqlpwrkikdkeqvgmi
    kekyehrmllkhmpsefhlfldhiasldyftkpdyqlimsvfensmkergiaeneafdwe
    kagtdallstststppqqntrqtaamfgvvnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nfmA (A:)
    dilpanyvvkdrwkvlkkiggggfgeiyeamdlltrenvalkvesaqqpkqvlkmevavl
    kklqgkdhvcrfigcgrnekfnyvvmqlqgrnladlrrsqprgtftlsttlrlgkqiles
    ieaihsvgflhrdikpsnfamgrlpstyrkcymldfglarqytnttgdvrpprnvagfrg
    tvryasvnahknremgrhddlwslfymlvefavgqlpwrkikdkeqvgmikekyehrmll
    khmpsefhlfldhiasldyftkpdyqlimsvfensmkergiaeneafdwekag