PDB entry 4nfl

View 4nfl on RCSB PDB site
Description: Crystal structure of human mitochondrial 5'(3')-deoxyribonucleotidase in complex with the inhibitor NPB-T
Class: hydrolase/hydrolase inhibitor
Keywords: HAD-like, nucleotidase, mitochondria, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-10-31, released 2014-09-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.154
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'(3')-deoxyribonucleotidase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: NT5M, DNT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPB1 (5-200)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d4nfla1, d4nfla2
  • Heterogens: MG, PO4, 2JW, TRS, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4nflA (A:)
    snaasggralrvlvdmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrp
    glsekaisiwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyaw
    vekyfgpdfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqp
    prrrlhswaddwkaildskrp