PDB entry 4nfg

View 4nfg on RCSB PDB site
Description: K13R mutant of horse cytochrome c and yeast cytochrome c peroxidase complex
Class: oxidoreductase/electron transport
Keywords: oxidoreductase/electron transport, OXIDOREDUCTASE-ELECTRON TRANSPORT complex
Deposited on 2013-10-31, released 2014-09-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.177
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (3-293)
      • expression tag (1-2)
      • conflict (127)
    Domains in SCOPe 2.06: d4nfga1, d4nfga2
  • Chain 'B':
    Compound: cytochrome c
    Species: Equus caballus [TaxId:9796]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00004 (0-103)
      • engineered mutation (12)
      • conflict (25)
      • conflict (32)
    Domains in SCOPe 2.06: d4nfgb_
  • Heterogens: HEM, UNX, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nfgA (A:)
    mktlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwragrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nfgA (A:)
    ktlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
    ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
    pkipwragrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
    lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
    pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4nfgB (B:)
    gdvekgkkifvqrcaqchtvekggknktgpnlnglfgrktgqapgftytdanknkgitwk
    eetlmeylenpkkyipgtkmifagikkkteredliaylkkatne