PDB entry 4nfb

View 4nfb on RCSB PDB site
Description: Structure of paired immunoglobulin-like type 2 receptor (PILR )
Deposited on 2013-10-31, released 2014-05-28
The last revision was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.199
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Paired immunoglobulin-like type 2 receptor alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PILR, PILRA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UKJ1 (1-119)
      • expression tag (0)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4nfbA (A:)
mlygvtqpkhlsasmggsveipfsfyypwelatapdvriswrrghfhrqsfystrppsih
kdyvnrlflnwtegqksgflrisnlqkqdqsvyfcrveldtrssgrqqwqsiegtklsit