PDB entry 4ne3

View 4ne3 on RCSB PDB site
Description: Human MHF1-MHF2 complex
Deposited on 2013-10-28, released 2013-12-25
The last revision was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.232
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Centromere protein S
    Species: Homo sapiens [TaxId:9606]
    Gene: APITD1, CENPS, FAAP16, MHF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N2Z9 (0-91)
      • conflict (25)
      • expression tag (92)
  • Chain 'B':
    Compound: Centromere protein X
    Species: Homo sapiens [TaxId:9606]
    Gene: STRA13, CENPX, FAAP10, MHF2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4ne3A (A:)
syqqrlkaavhytvgclceevaldkamqfskqtiaaiseltfrqcenfakdlemfarhak
rttintedvkllarrsnsllkyitdkseeiaqa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >4ne3B (B:)
sgfrkelvsrllhlhfkddktkvsgdalqlmvellkvfvveaavrgvrqaqaedalrvdv
dqlekvlpqllldf