PDB entry 4ndd

View 4ndd on RCSB PDB site
Description: X-ray structure of a double mutant of calexcitin - a neuronal calcium-signalling protein
Class: signaling protein
Keywords: EF-hand, calcium binding, neuron, SIGNALING PROTEIN
Deposited on 2013-10-25, released 2014-10-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calexcitin
    Species: Doryteuthis pealeii [TaxId:1051067]
    Gene: Cex
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76764 (Start-211)
      • engineered mutation (81)
      • engineered mutation (208)
    Domains in SCOPe 2.06: d4ndda_
  • Chain 'B':
    Compound: calexcitin
    Species: Doryteuthis pealeii [TaxId:1051067]
    Gene: Cex
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76764 (Start-211)
      • engineered mutation (81)
      • engineered mutation (208)
    Domains in SCOPe 2.06: d4nddb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nddA (A:)
    mghhhhhhhhhhssghiegrhmaahqlsdfqrnkilrvfntfydcnhdgviewddfelai
    kkicnlhswptdgkkhnearadlkliwdglrkyadenedeqvtkeewlkmwaecvksvek
    geslpewltkymnfmfdvndtsgdniidkheystvymsygipksdcdaafdtlsdggktm
    vtreifarlwteyfvsndrgakgnhlfgdlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nddA (A:)
    qlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhnearadlkl
    iwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndtsgdn
    iidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrgakgnh
    lfgdlkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nddB (B:)
    mghhhhhhhhhhssghiegrhmaahqlsdfqrnkilrvfntfydcnhdgviewddfelai
    kkicnlhswptdgkkhnearadlkliwdglrkyadenedeqvtkeewlkmwaecvksvek
    geslpewltkymnfmfdvndtsgdniidkheystvymsygipksdcdaafdtlsdggktm
    vtreifarlwteyfvsndrgakgnhlfgdlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nddB (B:)
    qlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhnearadlkl
    iwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndtsgdn
    iidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrgakgnh
    lfgdlkl