PDB entry 4nd5

View 4nd5 on RCSB PDB site
Description: Crystal structure of the lactate dehydrogenase from cryptosporidium parvum
Class: oxidoreductase
Keywords: apoenzyme structure, oxidoreductase
Deposited on 2013-10-25, released 2014-12-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactate dehydrogenase, adjacent gene encodes predicted malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd7_480, LDH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CYZ2 (0-End)
      • see remark 999 (183)
    Domains in SCOPe 2.07: d4nd5a1, d4nd5a2
  • Chain 'B':
    Compound: Lactate dehydrogenase, adjacent gene encodes predicted malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd7_480, LDH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CYZ2 (0-End)
      • see remark 999 (183)
    Domains in SCOPe 2.07: d4nd5b1, d4nd5b2
  • Chain 'C':
    Compound: Lactate dehydrogenase, adjacent gene encodes predicted malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd7_480, LDH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CYZ2
      • see remark 999 (183)
    Domains in SCOPe 2.07: d4nd5c1, d4nd5c2
  • Chain 'D':
    Compound: Lactate dehydrogenase, adjacent gene encodes predicted malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd7_480, LDH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CYZ2
      • see remark 999 (183)
    Domains in SCOPe 2.07: d4nd5d1, d4nd5d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nd5A (A:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nd5A (A:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitallfgnarildsvaegvkkycpnafvicitnpldvmvshfq
    kvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdgmvpatssvsvgg
    vplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaavkmaeaylkdkk
    avvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllgesinevntiskv
    ld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nd5B (B:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nd5B (B:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitallfgnarildsvaegvkkycpnafvicitnpldvmvshfq
    kvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdgmvpatssvsvgg
    vplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaavkmaeaylkdkk
    avvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllgesinevntiskv
    l
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nd5C (C:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nd5C (C:)
    ierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstskv
    igtndyadisgsdvviitallfgnarildsvaegvkkycpnafvicitnpldvmvshfqk
    vsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdgmvpatssvsvggv
    plssfikqglitqeqideivchtriawkevadnlktgtayfapaaaavkmaeaylkdkka
    vvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllgesinevntiskvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nd5D (D:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nd5D (D:)
    ierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstskv
    igtndyadisgsdvviitallfgnarildsvaegvkkycpnafvicitnpldvmvshfqk
    vsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdgmvpatssvsvggv
    plssfikqglitqeqideivchtriawkevadnlktgtayfapaaaavkmaeaylkdkka
    vvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllgesinevntisk