PDB entry 4ncq

View 4ncq on RCSB PDB site
Description: Crystal structure of NiSOD H1A mutant
Class: oxidoreductase
Keywords: antioxidant, hexamer, superoxide dismutase, NiSOD, SOD, oxidoreductase, metal-binding, Ni-binding, Ni
Deposited on 2013-10-24, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: 2SC7G11.16c, SCO5254, sod1, sodN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ncqa_
  • Chain 'B':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: 2SC7G11.16c, SCO5254, sod1, sodN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ncqb_
  • Chain 'C':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: 2SC7G11.16c, SCO5254, sod1, sodN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ncqc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ncqA (A:)
    acdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ncqA (A:)
    cgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkp
    phfekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ncqB (B:)
    acdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ncqB (B:)
    vydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkpph
    fekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ncqC (C:)
    acdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ncqC (C:)
    vydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkpph
    fekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkk