PDB entry 4nc1

View 4nc1 on RCSB PDB site
Description: Crystal Structure of TcdA-A2 Bound to A20.1 VHH and A26.8 VHH
Class: immune system
Keywords: Antibody-antigen complex, IMMUNE SYSTEM
Deposited on 2013-10-23, released 2013-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.205
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell wall-binding repeat protein
    Species: Clostridium difficile [TaxId:525258]
    Gene: HMPREF0219_0762, TcdA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cell wall-binding repeat protein
    Species: Clostridium difficile [TaxId:525258]
    Gene: HMPREF0219_0762, TcdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot D5RWT1 (13-End)
      • expression tag (11-12)
  • Chain 'C':
    Compound: a20.1 vhh
    Species: Lama glama [TaxId:9844]
    Gene: VHH
    Database cross-references and differences (RAF-indexed):
    • PDB 4NC1
    Domains in SCOPe 2.07: d4nc1c_
  • Chain 'D':
    Compound: a20.1 vhh
    Species: Lama glama [TaxId:9844]
    Gene: VHH
    Database cross-references and differences (RAF-indexed):
    • PDB 4NC1
    Domains in SCOPe 2.07: d4nc1d_
  • Chain 'E':
    Compound: a26.8 vhh
    Species: Lama glama [TaxId:9844]
    Gene: VHH
    Database cross-references and differences (RAF-indexed):
    • PDB 4NC1
    Domains in SCOPe 2.07: d4nc1e1, d4nc1e2
  • Chain 'F':
    Compound: a26.8 vhh
    Species: Lama glama [TaxId:9844]
    Gene: VHH
    Database cross-references and differences (RAF-indexed):
    • PDB 4NC1
    Domains in SCOPe 2.07: d4nc1f1, d4nc1f2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nc1C (C:)
    qpamaqaqvqlvesggglaqaggslrlscaasgrtfsmdpmawfrqppgkerefvaagss
    tgrttyyadsvkgrftisrdnakntvylqmnslkpedtavyycaaapyganwyrdeyayw
    gqgtqvtvssgqagqgseqkliseedlnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nc1C (C:)
    qvqlvesggglaqaggslrlscaasgrtfsmdpmawfrqppgkerefvaagsstgrttyy
    adsvkgrftisrdnakntvylqmnslkpedtavyycaaapyganwyrdeyaywgqgtqvt
    vss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nc1D (D:)
    qpamaqaqvqlvesggglaqaggslrlscaasgrtfsmdpmawfrqppgkerefvaagss
    tgrttyyadsvkgrftisrdnakntvylqmnslkpedtavyycaaapyganwyrdeyayw
    gqgtqvtvssgqagqgseqkliseedlnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nc1D (D:)
    qvqlvesggglaqaggslrlscaasgrtfsmdpmawfrqppgkerefvaagsstgrttyy
    adsvkgrftisrdnakntvylqmnslkpedtavyycaaapyganwyrdeyaywgqgtqvt
    vs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4nc1E (E:)
    qvkleesggglvqaggslrlscaasertfsrypvawfrqapgaerefvavisstgtstyy
    adsvkgrftisrdnakvtvylqmnnlkredtavyfcavnsqrtrlqdpneydywgqgtqv
    tvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nc1E (E:)
    vkleesggglvqaggslrlscaasertfsrypvawfrqapgaerefvavisstgtstyya
    dsvkgrftisrdnakvtvylqmnnlkredtavyfcavnsqrtrlqdpneydywgqgtqvt
    vssh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4nc1F (F:)
    qvkleesggglvqaggslrlscaasertfsrypvawfrqapgaerefvavisstgtstyy
    adsvkgrftisrdnakvtvylqmnnlkredtavyfcavnsqrtrlqdpneydywgqgtqv
    tvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nc1F (F:)
    vkleesggglvqaggslrlscaasertfsrypvawfrqapgaerefvavisstgtstyya
    dsvkgrftisrdnakvtvylqmnnlkredtavyfcavnsqrtrlqdpneydywgqgtqvt
    vss