PDB entry 4nbx

View 4nbx on RCSB PDB site
Description: Crystal Structure of Clostridium difficile Toxin A fragment TcdA-A1 Bound to A20.1 VHH
Class: immune system
Keywords: Antibody-antigen complex, IMMUNE SYSTEM
Deposited on 2013-10-23, released 2013-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TcdA
    Species: Clostridium difficile [TaxId:1496]
    Gene: tcdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6YE93 (6-142)
      • expression tag (0-5)
  • Chain 'B':
    Compound: a20.1 vhh
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NBX
    Domains in SCOPe 2.07: d4nbxb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nbxB (B:)
    qpamaqaqvqlvesggglaqaggslrlscaasgrtfsmdpmawfrqppgkerefvaagss
    tgrttyyadsvkgrftisrdnakntvylqmnslkpedtavyycaaapyganwyrdeyayw
    gqgtqvtvssgqagqgseqkliseedlnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbxB (B:)
    qvqlvesggglaqaggslrlscaasgrtfsmdpmawfrqppgkerefvaagsstgrttyy
    adsvkgrftisrdnakntvylqmnslkpedtavyycaaapyganwyrdeyaywgqgtqvt
    vss