PDB entry 4nbu

View 4nbu on RCSB PDB site
Description: Crystal structure of FabG from Bacillus sp
Class: oxidoreductase
Keywords: reductase, OXIDOREDUCTASE
Deposited on 2013-10-23, released 2013-12-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.156
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: Bacillus sp. SG-1 [TaxId:161544]
    Gene: BSG1_13201
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4nbua_
  • Chain 'B':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: Bacillus sp. SG-1 [TaxId:161544]
    Gene: BSG1_13201
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6CQL2 (7-249)
      • expression tag (6)
    Domains in SCOPe 2.05: d4nbub_
  • Chain 'C':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: Bacillus sp. SG-1 [TaxId:161544]
    Gene: BSG1_13201
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4nbuc_
  • Chain 'D':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: Bacillus sp. SG-1 [TaxId:161544]
    Gene: BSG1_13201
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4nbud_
  • Heterogens: NAI, CAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nbuA (A:)
    mhhhhhhmsrlqdkvaiitgaangigleaarvfmkegakvviadfneaagkeaveanpgv
    vfirvdvsdresvhrlvenvaerfgkidilinnagitrdsmlskmtvdqfqqvinvnltg
    vfhctqavlpymaeqgkgkiintssvtgtygnvgqtnyaaakagvigmtktwakelarkg
    invnavapgftetamvaevpekviekmkaqvpmgrlgkpedianaylflashesdyvngh
    vlhvdggimm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbuA (A:)
    srlqdkvaiitgaangigleaarvfmkegakvviadfneaagkeaveanpgvvfirvdvs
    dresvhrlvenvaerfgkidilinnagitrdsmlskmtvdqfqqvinvnltgvfhctqav
    lpymaeqgkgkiintssvtgtygnvgqtnyaaakagvigmtktwakelarkginvnavap
    gftetamvaevpekviekmkaqvpmgrlgkpedianaylflashesdyvnghvlhvdggi
    mm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nbuB (B:)
    mhhhhhhmsrlqdkvaiitgaangigleaarvfmkegakvviadfneaagkeaveanpgv
    vfirvdvsdresvhrlvenvaerfgkidilinnagitrdsmlskmtvdqfqqvinvnltg
    vfhctqavlpymaeqgkgkiintssvtgtygnvgqtnyaaakagvigmtktwakelarkg
    invnavapgftetamvaevpekviekmkaqvpmgrlgkpedianaylflashesdyvngh
    vlhvdggimm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbuB (B:)
    hmsrlqdkvaiitgaangigleaarvfmkegakvviadfneaagkeaveanpgvvfirvd
    vsdresvhrlvenvaerfgkidilinnagitrdsmlskmtvdqfqqvinvnltgvfhctq
    avlpymaeqgkgkiintssvtgtygnvgqtnyaaakagvigmtktwakelarkginvnav
    apgftetamvaevpekviekmkaqvpmgrlgkpedianaylflashesdyvnghvlhvdg
    gimm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nbuC (C:)
    mhhhhhhmsrlqdkvaiitgaangigleaarvfmkegakvviadfneaagkeaveanpgv
    vfirvdvsdresvhrlvenvaerfgkidilinnagitrdsmlskmtvdqfqqvinvnltg
    vfhctqavlpymaeqgkgkiintssvtgtygnvgqtnyaaakagvigmtktwakelarkg
    invnavapgftetamvaevpekviekmkaqvpmgrlgkpedianaylflashesdyvngh
    vlhvdggimm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbuC (C:)
    srlqdkvaiitgaangigleaarvfmkegakvviadfneaagkeaveanpgvvfirvdvs
    dresvhrlvenvaerfgkidilinnagitrdsmlskmtvdqfqqvinvnltgvfhctqav
    lpymaeqgkgkiintssvtgtygnvgqtnyaaakagvigmtktwakelarkginvnavap
    gftetamvaevpekviekmkaqvpmgrlgkpedianaylflashesdyvnghvlhvdggi
    mm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nbuD (D:)
    mhhhhhhmsrlqdkvaiitgaangigleaarvfmkegakvviadfneaagkeaveanpgv
    vfirvdvsdresvhrlvenvaerfgkidilinnagitrdsmlskmtvdqfqqvinvnltg
    vfhctqavlpymaeqgkgkiintssvtgtygnvgqtnyaaakagvigmtktwakelarkg
    invnavapgftetamvaevpekviekmkaqvpmgrlgkpedianaylflashesdyvngh
    vlhvdggimm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbuD (D:)
    srlqdkvaiitgaangigleaarvfmkegakvviadfneaagkeaveanpgvvfirvdvs
    dresvhrlvenvaerfgkidilinnagitrdsmlskmtvdqfqqvinvnltgvfhctqav
    lpymaeqgkgkiintssvtgtygnvgqtnyaaakagvigmtktwakelarkginvnavap
    gftetamvaevpekviekmkaqvpmgrlgkpedianaylflashesdyvnghvlhvdggi
    mm