PDB entry 4nbt

View 4nbt on RCSB PDB site
Description: Crystal structure of FabG from Acholeplasma laidlawii
Class: oxidoreductase
Keywords: reductase, OXIDOREDUCTASE
Deposited on 2013-10-23, released 2013-12-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.129
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase
    Species: Acholeplasma laidlawii [TaxId:441768]
    Gene: fabG2, ACL_0504
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4nbta_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase
    Species: Acholeplasma laidlawii [TaxId:441768]
    Gene: fabG2, ACL_0504
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4nbtb_
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase
    Species: Acholeplasma laidlawii [TaxId:441768]
    Gene: fabG2, ACL_0504
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4nbtc_
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase
    Species: Acholeplasma laidlawii [TaxId:441768]
    Gene: fabG2, ACL_0504
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4nbtd_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nbtA (A:)
    mkklegkvavitggakglgqaialayaeegakviagdlgdltyshpnvegmylnvtdvtg
    vekfyqsvidkygkidilvnnagitkdamtrkmteaqwdavidvnlkgvfnltrlvgpqm
    qtngygsiinissvvgvfgnigqanyaatkagvigltmtwakefalkganvrvnaiapgy
    imtdilktvpqdlldkfaaltmlnrlgqpeeiakvalflasddasyvtgqtinvnggmrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbtA (A:)
    kklegkvavitggakglgqaialayaeegakviagdlgdltyshpnvegmylnvtdvtgv
    ekfyqsvidkygkidilvnnagitkdamtrkmteaqwdavidvnlkgvfnltrlvgpqmq
    tngygsiinissvvgvfgnigqanyaatkagvigltmtwakefalkganvrvnaiapgyi
    mtdilktvpqdlldkfaaltmlnrlgqpeeiakvalflasddasyvtgqtinvnggmrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nbtB (B:)
    mkklegkvavitggakglgqaialayaeegakviagdlgdltyshpnvegmylnvtdvtg
    vekfyqsvidkygkidilvnnagitkdamtrkmteaqwdavidvnlkgvfnltrlvgpqm
    qtngygsiinissvvgvfgnigqanyaatkagvigltmtwakefalkganvrvnaiapgy
    imtdilktvpqdlldkfaaltmlnrlgqpeeiakvalflasddasyvtgqtinvnggmrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbtB (B:)
    kklegkvavitggakglgqaialayaeegakviagdlgdltyshpnvegmylnvtdvtgv
    ekfyqsvidkygkidilvnnagitkdamtrkmteaqwdavidvnlkgvfnltrlvgpqmq
    tngygsiinissvvgvfgnigqanyaatkagvigltmtwakefalkganvrvnaiapgyi
    mtdilktvpqdlldkfaaltmlnrlgqpeeiakvalflasddasyvtgqtinvnggmrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nbtC (C:)
    mkklegkvavitggakglgqaialayaeegakviagdlgdltyshpnvegmylnvtdvtg
    vekfyqsvidkygkidilvnnagitkdamtrkmteaqwdavidvnlkgvfnltrlvgpqm
    qtngygsiinissvvgvfgnigqanyaatkagvigltmtwakefalkganvrvnaiapgy
    imtdilktvpqdlldkfaaltmlnrlgqpeeiakvalflasddasyvtgqtinvnggmrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbtC (C:)
    kklegkvavitggakglgqaialayaeegakviagdlgdltyshpnvegmylnvtdvtgv
    ekfyqsvidkygkidilvnnagitkdamtrkmteaqwdavidvnlkgvfnltrlvgpqmq
    tngygsiinissvvgvfgnigqanyaatkagvigltmtwakefalkganvrvnaiapgyi
    mtdilktvpqdlldkfaaltmlnrlgqpeeiakvalflasddasyvtgqtinvnggmrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nbtD (D:)
    mkklegkvavitggakglgqaialayaeegakviagdlgdltyshpnvegmylnvtdvtg
    vekfyqsvidkygkidilvnnagitkdamtrkmteaqwdavidvnlkgvfnltrlvgpqm
    qtngygsiinissvvgvfgnigqanyaatkagvigltmtwakefalkganvrvnaiapgy
    imtdilktvpqdlldkfaaltmlnrlgqpeeiakvalflasddasyvtgqtinvnggmrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbtD (D:)
    kklegkvavitggakglgqaialayaeegakviagdlgdltyshpnvegmylnvtdvtgv
    ekfyqsvidkygkidilvnnagitkdamtrkmteaqwdavidvnlkgvfnltrlvgpqmq
    tngygsiinissvvgvfgnigqanyaatkagvigltmtwakefalkganvrvnaiapgyi
    mtdilktvpqdlldkfaaltmlnrlgqpeeiakvalflasddasyvtgqtinvnggmrl