PDB entry 4nbj

View 4nbj on RCSB PDB site
Description: D-aminoacyl-tRNA deacylase (DTD) from Plasmodium falciparum in complex with D-tyrosyl-3'-aminoadenosine at 2.20 Angstrom resolution
Class: hydrolase
Keywords: DTD, DEACYLASE, DTD-like, HYDROLASE
Deposited on 2013-10-23, released 2013-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: DTD, PF11_0095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nbja_
  • Chain 'B':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: DTD, PF11_0095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nbjb_
  • Chain 'C':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: DTD, PF11_0095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nbjc_
  • Chain 'D':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: DTD, PF11_0095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nbjd_
  • Chain 'E':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: DTD, PF11_0095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nbje_
  • Chain 'F':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: DTD, PF11_0095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nbjf_
  • Chain 'G':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: DTD, PF11_0095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nbjg_
  • Chain 'H':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: DTD, PF11_0095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nbjh_
  • Heterogens: D3Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nbjA (A:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbjA (A:)
    mrvviqrvkgailsvrkenleiiseiknglicflgihkndtwedalyiirkclnlrlwnn
    dnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqy
    nddkikigkfgnymnidvtndgpvtiyidthdin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nbjB (B:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbjB (B:)
    mrvviqrvkgailsvrkeleiiseiknglicflgihkndtwedalyiirkclnlrlwnnd
    nktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqyn
    ddkikigkfgnymnidvtndgpvtiyidthdinl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nbjC (C:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbjC (C:)
    mrvviqrvkgailsvrkeleiiseiknglicflgihkndtwedalyiirkclnlrlwnnd
    nktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqyn
    ddkikigkfgnymnidvtndgpvtiyidthdi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nbjD (D:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbjD (D:)
    mrvviqrvkgailsvrkeleiiseiknglicflgihkndtwedalyiirkclnlrlwnnd
    nktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqyn
    ddkikigkfgnymnidvtndgpvtiyidthdinl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4nbjE (E:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbjE (E:)
    mrvviqrvkgailsvrkeleiiseiknglicflgihkndtwedalyiirkclnlrlwnnd
    nktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqyn
    ddkikigkfgnymnidvtndgpvtiyidthdi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4nbjF (F:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbjF (F:)
    mrvviqrvkgailsvrkleiiseiknglicflgihkndtwedalyiirkclnlrlwnndn
    ktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqynd
    dkikigkfgnymnidvtndgpvtiyidthdinl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4nbjG (G:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbjG (G:)
    mrvviqrvkgailsvrkeiiseiknglicflgihkndtwedalyiirkclnlrlwnndkt
    wdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqynddk
    ikigkfgnymnidvtndgpvtiyidthdinl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4nbjH (H:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nbjH (H:)
    mrvviqrvkgailsvrkeleiiseiknglicflgihkndtwedalyiirkclnlrlwnnd
    nktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqyn
    ddkikigkfgnymnidvtndgpvtiyidthdi