PDB entry 4nay

View 4nay on RCSB PDB site
Description: Crystal Structure of FosB from Staphylococcus aureus with Zn and Sulfate at 1.42 Angstrom Resolution - SAD Phasing
Class: transferase
Keywords: Bacillithiol-S-transferase, TRANSFERASE
Deposited on 2013-10-22, released 2014-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.131
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallothiol transferase FosB
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: fosB, SA2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60864 (7-End)
      • expression tag (5-6)
    Domains in SCOPe 2.08: d4naya1, d4naya2
  • Heterogens: SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nayA (A:)
    mhhhhhhlksinhicfsvrnlndsihfyrdillgkllltgkktayfelaglwialneekd
    iprneihfsythiaftiddsefkywhqrlkdnnvnilegrvrdirdrqsiyftdpdghkl
    elhtgtlenrlnyykeakphmtfyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nayA (A:)
    hhlksinhicfsvrnlndsihfyrdillgkllltgkktayfelaglwialneekdiprne
    ihfsythiaftiddsefkywhqrlkdnnvnilqsiyftdpdghklelhtgtlenrlnyyk
    eakphmtfy