PDB entry 4nax

View 4nax on RCSB PDB site
Description: Crystal structure of glutathione transferase PPUT_1760 from Pseudomonas putida, target EFI-507288, with one glutathione disulfide bound per one protein subunit
Class: transferase
Keywords: glutathione S-transferase, Enzyme Function Initiative, EFI, structural genomics, transferase
Deposited on 2013-10-22, released 2013-11-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.101
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase, N-terminal domain protein
    Species: Pseudomonas putida [TaxId:351746]
    Gene: Pput_1760
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5W1A6 (Start-230)
      • conflict (224)
      • expression tag (231-238)
    Domains in SCOPe 2.06: d4naxa1, d4naxa2, d4naxa3
  • Chain 'B':
    Compound: Glutathione S-transferase, N-terminal domain protein
    Species: Pseudomonas putida [TaxId:351746]
    Gene: Pput_1760
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5W1A6 (Start-230)
      • conflict (224)
    Domains in SCOPe 2.06: d4naxb1, d4naxb2
  • Heterogens: GDS, GOL, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4naxA (A:)
    mtelsafpitrkwpakhperlqlyslptpngvkvsimleeiglayeahkvsfdnddqlsp
    efislsannkipaildpngpggqplplfesgailqylaeksgqllsqdpaqryqtlqwlm
    fqmggigpmfgqvgffhffagkeyedkrprdryvneskrllgvldrhlkgrqwmaeeysi
    adiaifpwvrnlverynardlvgfdqfkevqrvlanflerpavqhglkipgaenlyfqgh
    hhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4naxA (A:)
    elsafpitrkwpakhperlqlyslptpngvkvsimleeiglayeahkvsfdnddqlspef
    islsannkipaildpngpggqplplfesgailqylaeksgqllsqdpaqryqtlqwlmfq
    mggigpmfgqvgffhffagkeyedkrprdryvneskrllgvldrhlkgrqwmaeeysiad
    iaifpwvrnlverynardlvgfdqfkevqrvlanflerpavqhglkipgaenlyfqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4naxB (B:)
    mtelsafpitrkwpakhperlqlyslptpngvkvsimleeiglayeahkvsfdnddqlsp
    efislsannkipaildpngpggqplplfesgailqylaeksgqllsqdpaqryqtlqwlm
    fqmggigpmfgqvgffhffagkeyedkrprdryvneskrllgvldrhlkgrqwmaeeysi
    adiaifpwvrnlverynardlvgfdqfkevqrvlanflerpavqhglkipgaenlyfqgh
    hhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4naxB (B:)
    telsafpitrkwpakhperlqlyslptpngvkvsimleeiglayeahkvsfdnddqlspe
    fislsannkipaildpngpggqplplfesgailqylaeksgqllsqdpaqryqtlqwlmf
    qmggigpmfgqvgffhffagkeyedkrprdryvneskrllgvldrhlkgrqwmaeeysia
    diaifpwvrnlverynardlvgfdqfkevqrvlanflerpavqhglkipg