PDB entry 4nas

View 4nas on RCSB PDB site
Description: The crystal structure of a rubisco-like protein (MtnW) from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Class: lyase
Keywords: structural genomics, PSI-Biology, protein structure initiative, midwest center for structural genomics, MCSG, LYASE
Deposited on 2013-10-22, released 2013-11-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose-bisphosphate carboxylase
    Species: Alicyclobacillus acidocaldarius subsp. acidocaldarius [TaxId:521098]
    Gene: Aaci_0096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nasa1, d4nasa2
  • Chain 'B':
    Compound: Ribulose-bisphosphate carboxylase
    Species: Alicyclobacillus acidocaldarius subsp. acidocaldarius [TaxId:521098]
    Gene: Aaci_0096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nasb1, d4nasb2
  • Chain 'C':
    Compound: Ribulose-bisphosphate carboxylase
    Species: Alicyclobacillus acidocaldarius subsp. acidocaldarius [TaxId:521098]
    Gene: Aaci_0096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nasc1, d4nasc2
  • Chain 'D':
    Compound: Ribulose-bisphosphate carboxylase
    Species: Alicyclobacillus acidocaldarius subsp. acidocaldarius [TaxId:521098]
    Gene: Aaci_0096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nasd1, d4nasd2
  • Heterogens: GOL, FMT, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nasA (A:)
    snanqdssprdavvatyrlrdrkdklearaegiavgltigtwtdlpaarksevakhcgrv
    egirvlderpdgdvvaeidiaypvanlngtfasllvtvfgklsmdgeirlerlqmpdelv
    rqfpgpkfgvegvrrrlgaynrplvmsifkacagltldelveafgeqaeggvdlvkddei
    ffteayatpedrvrayaakadeiaqrtgrrtayavnltgpvhslrerarrlaelgagall
    vnvvaygydvvadlardpdvdvpilahpavsgalygspnygiaadivlgqlmrlagadig
    ifpsmygsvtlgreatdrllqhlraegphkpvlpapsagiypglvprlyqdfgvdlvlna
    gggihghpggarmggraffdaiwavehgvpleeaakdrpalrqalekwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nasA (A:)
    sprdavvatyrlrdrkdklearaegiavgltigtwarksevakhcgrvegirvlderpdg
    dvvaeidiaypvanlngtfasllvtvfgklsmdgeirlerlqmpdelvrqfpgpkfgveg
    vrrrlgaynrplvmsifkacagltldelveafgeqaeggvdlvkddeiffteayatpedr
    vrayaakadeiaqrtgrrtayavnltgpvhslrerarrlaelgagallvnvvaygydvva
    dlardpdvdvpilahpavsgalygspnygiaadivlgqlmrlagadigifpsmygsvtlg
    reatdrllqhlraegphkpvlpapsagiypglvprlyqdfgvdlvlnagggihghpggar
    mggraffdaiwavehgvpleeaakdrpalrqalekwg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nasB (B:)
    snanqdssprdavvatyrlrdrkdklearaegiavgltigtwtdlpaarksevakhcgrv
    egirvlderpdgdvvaeidiaypvanlngtfasllvtvfgklsmdgeirlerlqmpdelv
    rqfpgpkfgvegvrrrlgaynrplvmsifkacagltldelveafgeqaeggvdlvkddei
    ffteayatpedrvrayaakadeiaqrtgrrtayavnltgpvhslrerarrlaelgagall
    vnvvaygydvvadlardpdvdvpilahpavsgalygspnygiaadivlgqlmrlagadig
    ifpsmygsvtlgreatdrllqhlraegphkpvlpapsagiypglvprlyqdfgvdlvlna
    gggihghpggarmggraffdaiwavehgvpleeaakdrpalrqalekwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nasB (B:)
    davvatyrlrdrkdklearaegiavgltigtwtdlpaarksevakhcgrvegirvlderp
    dgdvvaeidiaypvanlngtfasllvtvfgklsmdgeirlerlqmpdelvrqfpgpkfgv
    egvrrrlgaynrplvmsifkacagltldelveafgeqaeggvdlvkddeiffteayatpe
    drvrayaakadeiaqrtgrrtayavnltgpvhslrerarrlaelgagallvnvvaygydv
    vadlardpdvdvpilahpavsgalygspnygiaadivlgqlmrlagadigifpsmygsvt
    lgreatdrllqhlraegphkpvlpapsagiypglvprlyqdfgvdlvlnagggihghpgg
    armggraffdaiwavehgvpleeaakdrpalrqalekwg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nasC (C:)
    snanqdssprdavvatyrlrdrkdklearaegiavgltigtwtdlpaarksevakhcgrv
    egirvlderpdgdvvaeidiaypvanlngtfasllvtvfgklsmdgeirlerlqmpdelv
    rqfpgpkfgvegvrrrlgaynrplvmsifkacagltldelveafgeqaeggvdlvkddei
    ffteayatpedrvrayaakadeiaqrtgrrtayavnltgpvhslrerarrlaelgagall
    vnvvaygydvvadlardpdvdvpilahpavsgalygspnygiaadivlgqlmrlagadig
    ifpsmygsvtlgreatdrllqhlraegphkpvlpapsagiypglvprlyqdfgvdlvlna
    gggihghpggarmggraffdaiwavehgvpleeaakdrpalrqalekwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nasC (C:)
    davvatyrlrdrkdklearaegiavgltigtwpaarksevakhcgrvegirvlderpdgd
    vvaeidiaypvanlngtfasllvtvfgklsmdgeirlerlqmpdelvrqfpgpkfgvegv
    rrrlgaynrplvmsifkacagltldelveafgeqaeggvdlvkddeiffteayatpedrv
    rayaakadeiaqrtgrrtayavnltgpvhslrerarrlaelgagallvnvvaygydvvad
    lardpdvdvpilahpavsgalygspnygiaadivlgqlmrlagadigifpsmygsvtlgr
    eatdrllqhlraegphkpvlpapsagiypglvprlyqdfgvdlvlnagggihghpggarm
    ggraffdaiwavehgvpleeaakdrpalrqalekwg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nasD (D:)
    snanqdssprdavvatyrlrdrkdklearaegiavgltigtwtdlpaarksevakhcgrv
    egirvlderpdgdvvaeidiaypvanlngtfasllvtvfgklsmdgeirlerlqmpdelv
    rqfpgpkfgvegvrrrlgaynrplvmsifkacagltldelveafgeqaeggvdlvkddei
    ffteayatpedrvrayaakadeiaqrtgrrtayavnltgpvhslrerarrlaelgagall
    vnvvaygydvvadlardpdvdvpilahpavsgalygspnygiaadivlgqlmrlagadig
    ifpsmygsvtlgreatdrllqhlraegphkpvlpapsagiypglvprlyqdfgvdlvlna
    gggihghpggarmggraffdaiwavehgvpleeaakdrpalrqalekwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nasD (D:)
    rdavvatyrlrdrkdklearaegiavgltigtwrksvakhcgrvegirvlderpdgdvva
    eidiaypvanlngtfasllvtvfgklsmdgeirlerlqmpdelvrqfpgpkfgvegvrrr
    lgaynrplvmsifkacagltldelveafgeqaeggvdlvkddeiffteayatpedrvray
    aakadeiaqrtgrrtayavnltgpvhslrerarrlaelgagallvnvvaygydvvadlar
    dpdvdvpilahpavsgalygspnygiaadivlgqlmrlagadigifpsmygsvtlgreat
    drllqhlraegphkpvlpapsagiypglvprlyqdfgvdlvlnagggihghpggarmggr
    affdaiwavehgvpleeaakdrpalrqalekw