PDB entry 4naq

View 4naq on RCSB PDB site
Description: Crystal structure of porcine aminopeptidase-N complexed with poly-alanine
Class: hydrolase
Keywords: zinc-aminopeptidase, HYDROLASE
Deposited on 2013-10-22, released 2013-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.148
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Sus scrofa [TaxId:9823]
    Gene: ANPEP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15145 (0-899)
      • conflict (43)
      • conflict (320)
      • expression tag (900)
    Domains in SCOPe 2.07: d4naqa1, d4naqa2, d4naqa3, d4naqa4, d4naqa5
  • Chain 'B':
    Compound: poly A peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4NAQ (0-6)
  • Heterogens: NAG, SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4naqA (A:)
    skpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskkl
    nyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgelad
    dlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsn
    mppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwarpna
    iaeghgmyalnvtgpilnffanhyntsyplpksdqialpdfnagamenwglvtyrenall
    fdpqsssisnkervvtviahqlahqwfgnlvtlawwndlwlnegfasyveylgadhaept
    wnlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvirmls
    nfltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlqm
    gfpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsq
    aqndlfktasddwvllnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviydsf
    nlatahmvpvtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkqv
    eplfqhfetltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpenn
    pihpnlrstiycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnrylg
    ytlnpdlirkqdatstinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliqgvt
    rrfssefelqqleqfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfiehs
    shhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4naqA (A:)
    skpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskkl
    nyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgelad
    dlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsn
    mppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwarpna
    iaeghgmyalnvtgpilnffanhyntsyplpksdqialpdfnagamenwglvtyrenall
    fdpqsssisnkervvtviahqlahqwfgnlvtlawwndlwlnegfasyveylgadhaept
    wnlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvirmls
    nfltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlqm
    gfpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsq
    aqndlfktasddwvllnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviydsf
    nlatahmvpvtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkqv
    eplfqhfetltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpenn
    pihpnlrstiycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnrylg
    ytlnpdlirkqdatstinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliqgvt
    rrfssefelqqleqfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfiehs
    s
    

  • Chain 'B':
    No sequence available.