PDB entry 4nak

View 4nak on RCSB PDB site
Description: Arabidopsis thaliana IspD in complex with pentabromo-pseudilin
Class: transferase/transferase inhibitor
Keywords: herbicide, anti-infectives, pseudilin, natural product, drug discovery,allosteric inhibition, Rossmann Fold, Transferase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-10-22, released 2014-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g02500, ISPD, MCT, MECT, MEPCT, T8K22.20
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69834 (1-End)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d4naka_
  • Heterogens: PBQ, DTT, CD, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nakA (A:)
    meksvsvillaggqgkrmkmsmpkqyipllgqpialysfftfsrmpevkeivvvcdpffr
    difeeyeesidvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvl
    kdgsavgaavlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvks
    eglevtddvsiveylkhpvyvsqgsytnikvttpddlllaerilseds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nakA (A:)
    eksvsvillaggpkqyipllgqpialysfftfsrmpevkeivvvcdpffrdifeeyeesi
    dvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlkdgsavgaav
    lgvpakatikevnsdslvvktlwemqtpqvikpellkkgfelvkseglevtddvsiveyl
    khpvyvsqgsytnikvttpddlllaeril